SCOPe 2.08: Domain d4l4za_: 4l4z A:

Lineage for d4l4za_ (4l4z A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.0: automated matches [191609] (1 protein)
   not a true family

6. Protein automated matches [191112] (17 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [267961] (4 PDB entries)

8. Domain d4l4za_: 4l4z A: [266620]
   automated match to d4r9na_
   protein/DNA complex; complexed with d5x

Details for d4l4za_

PDB Entry: 4l4z, 2.3 Å

PDB Description: Crystal structures of the LsrR proteins complexed with phospho-AI-2 and its two different analogs reveal distinct mechanisms for ligand recognition

PDB Compounds: (A:) Transcriptional regulator LsrR

SCOPe Domain Sequences for d4l4za_:

Sequence; same for both SEQRES and ATOM records:

>d4l4za_ c.124.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
egcleyetqlrrqfslqhvrvipgladadvggrlgigaahmlmsllqpqqmlaigfgeat
mntlqrlsgfissqqirlvtlsggvgsymtgigqlnaacsvniipaplrassadiartlk
nencvkdvllaaqaadvaivgigavsqqddatiirsgyisqgeqlmigrkgavgdilgyf
fdakgdvvtnikihneliglplsalktipvrvgvaggenkaeaiaaamkggyinalvtdq
dtaaailrs

Timeline for d4l4za_:

• d4l4za_ first appeared in SCOPe 2.05
  
• d4l4za_ appears in SCOPe 2.07