Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Chromohalobacter salexigens [TaxId:290398] [232962] (8 PDB entries) |
Domain d4kwsd1: 4kws D:4-113 [266603] Other proteins in same PDB: d4kwsa2, d4kwsa3, d4kwsb2, d4kwsb3, d4kwsc2, d4kwsc3, d4kwsd2, d4kwsd3, d4kwse2, d4kwse3, d4kwsf2, d4kwsf3, d4kwsg2, d4kwsg3, d4kwsh2, d4kwsh3 automated match to d4il2a1 complexed with cl, gol, mg |
PDB Entry: 4kws (more details), 1.64 Å
SCOPe Domain Sequences for d4kwsd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kwsd1 d.54.1.0 (D:4-113) automated matches {Chromohalobacter salexigens [TaxId: 290398]} kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg
Timeline for d4kwsd1: