Lineage for d4kwsd1 (4kws D:4-113)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948105Species Chromohalobacter salexigens [TaxId:290398] [232962] (8 PDB entries)
  8. 2948110Domain d4kwsd1: 4kws D:4-113 [266603]
    Other proteins in same PDB: d4kwsa2, d4kwsa3, d4kwsb2, d4kwsb3, d4kwsc2, d4kwsc3, d4kwsd2, d4kwsd3, d4kwse2, d4kwse3, d4kwsf2, d4kwsf3, d4kwsg2, d4kwsg3, d4kwsh2, d4kwsh3
    automated match to d4il2a1
    complexed with cl, gol, mg

Details for d4kwsd1

PDB Entry: 4kws (more details), 1.64 Å

PDB Description: Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with Mg and glycerol
PDB Compounds: (D:) D-mannonate dehydratase

SCOPe Domain Sequences for d4kwsd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kwsd1 d.54.1.0 (D:4-113) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

SCOPe Domain Coordinates for d4kwsd1:

Click to download the PDB-style file with coordinates for d4kwsd1.
(The format of our PDB-style files is described here.)

Timeline for d4kwsd1: