SCOP 1.71: Domain d1a8ga_: 1a8g A:

Lineage for d1a8ga_ (1a8g A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (179 PDB entries)

8. Domain d1a8ga_: 1a8g A: [26660]

Details for d1a8ga_

PDB Entry: 1a8g, 2.5 Å

PDB Description: hiv-1 protease in complex with sdz283-910

SCOP Domain Sequences for d1a8ga_:

Sequence; same for both SEQRES and ATOM records:

>d1a8ga_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d1a8ga_:

• d1a8ga_ first appeared (with stable ids) in SCOP 1.55
  
• d1a8ga_ appears in SCOP 1.69
  
• d1a8ga_ appears in SCOP 1.73
  
• d1a8ga_ appears in the current release, SCOPe 2.08