SCOPe 2.05: Domain d4kple1: 4kpl E:3-113

Lineage for d4kple1 (4kpl E:3-113)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:290398] [232962] (8 PDB entries)

8. Domain d4kple1: 4kpl E:3-113 [266567]
   Other proteins in same PDB: d4kpla2, d4kplb2, d4kplc2, d4kpld2, d4kple2, d4kplf2, d4kplg2, d4kplh2
   automated match to d4il2a1
   complexed with cl, cs2, gol, kdg, mg

Details for d4kple1

PDB Entry: 4kpl, 2 Å

PDB Description: Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with Mg,d-mannonate and 2-keto-3-deoxy-d-gluconate

PDB Compounds: (E:) D-mannonate dehydratase

SCOPe Domain Sequences for d4kple1:

Sequence; same for both SEQRES and ATOM records:

>d4kple1 d.54.1.0 (E:3-113) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

Timeline for d4kple1:

• d4kple1 is new in SCOPe 2.05-stable
  
• d4kple1 appears in SCOPe 2.06
  
• d4kple1 appears in the current release, SCOPe 2.08