Lineage for d4k4im1 (4k4i M:249-328)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001491Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2001492Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2001661Protein DNA polymerase lambda [101251] (1 species)
  7. 2001662Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries)
  8. 2001711Domain d4k4im1: 4k4i M:249-328 [266529]
    Other proteins in same PDB: d4k4ia2, d4k4ia3, d4k4ia4, d4k4ie2, d4k4ie3, d4k4ie4, d4k4ii2, d4k4ii3, d4k4ii4, d4k4im2, d4k4im3, d4k4im4
    automated match to d3hw8a1
    protein/DNA complex; complexed with 1ry, act, ca, cac

Details for d4k4im1

PDB Entry: 4k4i (more details), 2.25 Å

PDB Description: ternary crystal structures of a human dna polymerase lambda in complex with dna and (-)ftc-tp.
PDB Compounds: (M:) DNA polymerase lambda

SCOPe Domain Sequences for d4k4im1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k4im1 a.60.6.1 (M:249-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
maekiieilesghlrkldhi

SCOPe Domain Coordinates for d4k4im1:

Click to download the PDB-style file with coordinates for d4k4im1.
(The format of our PDB-style files is described here.)

Timeline for d4k4im1: