Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) contains one classic and one pseudo HhH motifs |
Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
Protein DNA polymerase lambda [101251] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries) |
Domain d4k4im1: 4k4i M:249-328 [266529] Other proteins in same PDB: d4k4ia2, d4k4ia3, d4k4ia4, d4k4ie2, d4k4ie3, d4k4ie4, d4k4ii2, d4k4ii3, d4k4ii4, d4k4im2, d4k4im3, d4k4im4 automated match to d3hw8a1 protein/DNA complex; complexed with 1ry, act, ca, cac |
PDB Entry: 4k4i (more details), 2.25 Å
SCOPe Domain Sequences for d4k4im1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k4im1 a.60.6.1 (M:249-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr maekiieilesghlrkldhi
Timeline for d4k4im1: