Lineage for d4k4ie2 (4k4i E:329-385)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716398Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716399Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 2716577Protein DNA polymerase lambda [101253] (1 species)
  7. 2716578Species Human (Homo sapiens) [TaxId:9606] [101254] (27 PDB entries)
  8. 2716606Domain d4k4ie2: 4k4i E:329-385 [266524]
    Other proteins in same PDB: d4k4ia1, d4k4ia3, d4k4ia4, d4k4ie1, d4k4ie3, d4k4ie4, d4k4ii1, d4k4ii3, d4k4ii4, d4k4im1, d4k4im3, d4k4im4
    automated match to d2bcqa2
    protein/DNA complex; complexed with 1ry, act, ca, cac

Details for d4k4ie2

PDB Entry: 4k4i (more details), 2.25 Å

PDB Description: ternary crystal structures of a human dna polymerase lambda in complex with dna and (-)ftc-tp.
PDB Compounds: (E:) DNA polymerase lambda

SCOPe Domain Sequences for d4k4ie2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k4ie2 a.60.12.1 (E:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d4k4ie2:

Click to download the PDB-style file with coordinates for d4k4ie2.
(The format of our PDB-style files is described here.)

Timeline for d4k4ie2: