SCOPe 2.05: Domain d4k2sc2: 4k2s C:114-405

Lineage for d4k2sc2 (4k2s C:114-405)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:290398] [232967] (8 PDB entries)

8. Domain d4k2sc2: 4k2s C:114-405 [266501]
   Other proteins in same PDB: d4k2sa1, d4k2sb1, d4k2sc1, d4k2sd1, d4k2se1, d4k2sf1, d4k2sg1, d4k2sh1
   automated match to d4il2a2
   complexed with cl, gco, gol, mg; mutant

Details for d4k2sc2

PDB Entry: 4k2s, 1.7 Å

PDB Description: crystal structure of the mutant p317a of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate

PDB Compounds: (C:) D-mannonate dehydratase

SCOPe Domain Sequences for d4k2sc2:

Sequence, based on SEQRES records:

>d4k2sc2 c.1.11.0 (C:114-405) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Sequence, based on observed residues (ATOM records):

>d4k2sc2 c.1.11.0 (C:114-405) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvasslpaehvw
stekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpa
enqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadl
aslyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedgh
flagespghgvdideelaakypyeraslpvnrledgtlwhw

Timeline for d4k2sc2:

• d4k2sc2 is new in SCOPe 2.05-stable
  
• d4k2sc2 appears in SCOPe 2.06
  
• d4k2sc2 appears in the current release, SCOPe 2.08