Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
Superfamily f.19.1: Aquaporin-like [81338] (2 families) |
Family f.19.1.0: automated matches [191436] (1 protein) not a true family |
Protein automated matches [190629] (7 species) not a true protein |
Species Spinach (Spinacia oleracea) [TaxId:3562] [255773] (6 PDB entries) |
Domain d4jc6c_: 4jc6 C: [266470] automated match to d4ia4c_ complexed with bog, cd, hg |
PDB Entry: 4jc6 (more details), 2.15 Å
SCOPe Domain Sequences for d4jc6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jc6c_ f.19.1.0 (C:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]} papffdlgelklwsfwraaiaefiatllflyitvatvighsketvvcgsvgllgiawafg gmifvlvyctagisgghinpavtfglflarkvsllralvymiaqclgaicgvglvkafmk gpynqfgggansvalgynkgtalgaeiigtfvlvytvfsatdpkrsardshvpilaplpi gfavfmvhlatipitgtginparsfgaavifnsnkvwddqwifwvgpfigaavaaayhqy vlraaaika
Timeline for d4jc6c_: