Lineage for d4jc6c_ (4jc6 C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024308Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 3024309Superfamily f.19.1: Aquaporin-like [81338] (2 families) (S)
  5. 3024360Family f.19.1.0: automated matches [191436] (1 protein)
    not a true family
  6. 3024361Protein automated matches [190629] (7 species)
    not a true protein
  7. 3024403Species Spinach (Spinacia oleracea) [TaxId:3562] [255773] (6 PDB entries)
  8. 3024410Domain d4jc6c_: 4jc6 C: [266470]
    automated match to d4ia4c_
    complexed with bog, cd, hg

Details for d4jc6c_

PDB Entry: 4jc6 (more details), 2.15 Å

PDB Description: mercury activation of the plant aquaporin sopip2;1 - structural and functional characterization
PDB Compounds: (C:) aquaporin

SCOPe Domain Sequences for d4jc6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jc6c_ f.19.1.0 (C:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
papffdlgelklwsfwraaiaefiatllflyitvatvighsketvvcgsvgllgiawafg
gmifvlvyctagisgghinpavtfglflarkvsllralvymiaqclgaicgvglvkafmk
gpynqfgggansvalgynkgtalgaeiigtfvlvytvfsatdpkrsardshvpilaplpi
gfavfmvhlatipitgtginparsfgaavifnsnkvwddqwifwvgpfigaavaaayhqy
vlraaaika

SCOPe Domain Coordinates for d4jc6c_:

Click to download the PDB-style file with coordinates for d4jc6c_.
(The format of our PDB-style files is described here.)

Timeline for d4jc6c_: