SCOPe 2.05: Domain d4im4c_: 4im4 C:

Lineage for d4im4c_ (4im4 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [267951] (1 PDB entry)

8. Domain d4im4c_: 4im4 C: [266450]
   automated match to d3rjya_

Details for d4im4c_

PDB Entry: 4im4, 2.42 Å

PDB Description: multifunctional cellulase, xylanase, mannanase

PDB Compounds: (C:) endoglucanase e

SCOPe Domain Sequences for d4im4c_:

Sequence; same for both SEQRES and ATOM records:

>d4im4c_ c.1.8.0 (C:) automated matches {Clostridium thermocellum [TaxId: 1515]}
gmrdisaidlvkeikigwnlgntldaptetawgnprttkamiekvremgfnavrvpvtwd
thigpapdykideawlnrveevvnyvldcgmyaiinlhhdntwiiptyaneqrskeklvk
vweqiatrfkdyddhllfetmneprevgspmewmggtyenrdvinrfnlavvntirasgg
nndkrfilvptnaatgldvalndlvipnndsrvivsihayspyffamdvngtsywgsdyd
kasltseldaiynrfvkngraviigefgtidknnlssrvahaehyareavsrgiavfwwd
ngyynpgdaetyallnrktlswyypeivqalmrgag

Timeline for d4im4c_:

• d4im4c_ is new in SCOPe 2.05-stable
  
• d4im4c_ appears in SCOPe 2.06
  
• d4im4c_ appears in the current release, SCOPe 2.08