Lineage for d4il2d1 (4il2 D:13-122)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1904961Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1905006Protein D-mannonate dehydratase [267663] (1 species)
  7. 1905007Species Escherichia coli [TaxId:199310] [267746] (1 PDB entry)
  8. 1905011Domain d4il2d1: 4il2 D:13-122 [266446]
    Other proteins in same PDB: d4il2a2, d4il2b2, d4il2c2, d4il2d2
    complexed with mg

Details for d4il2d1

PDB Entry: 4il2 (more details), 1.95 Å

PDB Description: crystal structure of d-mannonate dehydratase (rspa) from e. coli cft073 (efi target efi-501585)
PDB Compounds: (D:) Starvation sensing protein rspA

SCOPe Domain Sequences for d4il2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il2d1 d.54.1.1 (D:13-122) D-mannonate dehydratase {Escherichia coli [TaxId: 199310]}
kivkaevfvtcpgrnfvtlkittedgitglgdatlngrelsvasylqdhlcpqligrdah
riediwqffykgaywrrgpvtmsaisavdmalwdikakaanmplyqllgg

SCOPe Domain Coordinates for d4il2d1:

Click to download the PDB-style file with coordinates for d4il2d1.
(The format of our PDB-style files is described here.)

Timeline for d4il2d1: