Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
Protein D-mannonate dehydratase [267663] (1 species) |
Species Escherichia coli [TaxId:199310] [267746] (1 PDB entry) |
Domain d4il2c1: 4il2 C:12-122 [266444] Other proteins in same PDB: d4il2a2, d4il2b2, d4il2c2, d4il2d2 complexed with mg |
PDB Entry: 4il2 (more details), 1.95 Å
SCOPe Domain Sequences for d4il2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4il2c1 d.54.1.1 (C:12-122) D-mannonate dehydratase {Escherichia coli [TaxId: 199310]} mkivkaevfvtcpgrnfvtlkittedgitglgdatlngrelsvasylqdhlcpqligrda hriediwqffykgaywrrgpvtmsaisavdmalwdikakaanmplyqllgg
Timeline for d4il2c1: