Lineage for d4il2b2 (4il2 B:123-415)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1823470Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1823572Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 1823617Protein D-mannonate dehydratase [267664] (1 species)
  7. 1823618Species Escherichia coli [TaxId:199310] [267747] (1 PDB entry)
  8. 1823620Domain d4il2b2: 4il2 B:123-415 [266443]
    Other proteins in same PDB: d4il2a1, d4il2b1, d4il2c1, d4il2d1
    complexed with mg

Details for d4il2b2

PDB Entry: 4il2 (more details), 1.95 Å

PDB Description: crystal structure of d-mannonate dehydratase (rspa) from e. coli cft073 (efi target efi-501585)
PDB Compounds: (B:) Starvation sensing protein rspA

SCOPe Domain Sequences for d4il2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il2b2 c.1.11.2 (B:123-415) D-mannonate dehydratase {Escherichia coli [TaxId: 199310]}
asregvmvychttghsidealddyarhqelgfkairvqcgipgmkttygmskgkglayep
atkgqwpeeqlwstekyldfmpklfdavrnkfgfdehllhdmhhrltpieaarfgksied
yrmfwmedptpaenqecfrlirqhtvtpiavgevfnsiwdckqlieeqlidyirttltha
ggitgmrriadfaslyqvrtgshgpsdlspvcmaaalhfdlwvpnfgvqeymgyseqmle
vfphnwtfdngymhpgekpglgiefdeklaakypyepaylpvarledgtlwnw

SCOPe Domain Coordinates for d4il2b2:

Click to download the PDB-style file with coordinates for d4il2b2.
(The format of our PDB-style files is described here.)

Timeline for d4il2b2: