SCOPe 2.08: Domain d4il2b2: 4il2 B:123-415

Lineage for d4il2b2 (4il2 B:123-415)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein D-mannonate dehydratase [267664] (1 species)

7. Species Escherichia coli [TaxId:199310] [267747] (1 PDB entry)

8. Domain d4il2b2: 4il2 B:123-415 [266443]
   Other proteins in same PDB: d4il2a1, d4il2b1, d4il2c1, d4il2d1
   complexed with mg

Details for d4il2b2

PDB Entry: 4il2, 1.95 Å

PDB Description: crystal structure of d-mannonate dehydratase (rspa) from e. coli cft073 (efi target efi-501585)

PDB Compounds: (B:) Starvation sensing protein rspA

SCOPe Domain Sequences for d4il2b2:

Sequence; same for both SEQRES and ATOM records:

>d4il2b2 c.1.11.2 (B:123-415) D-mannonate dehydratase {Escherichia coli [TaxId: 199310]}
asregvmvychttghsidealddyarhqelgfkairvqcgipgmkttygmskgkglayep
atkgqwpeeqlwstekyldfmpklfdavrnkfgfdehllhdmhhrltpieaarfgksied
yrmfwmedptpaenqecfrlirqhtvtpiavgevfnsiwdckqlieeqlidyirttltha
ggitgmrriadfaslyqvrtgshgpsdlspvcmaaalhfdlwvpnfgvqeymgyseqmle
vfphnwtfdngymhpgekpglgiefdeklaakypyepaylpvarledgtlwnw

Timeline for d4il2b2:

• d4il2b2 first appeared in SCOPe 2.05
  
• d4il2b2 appears in SCOPe 2.07