SCOPe 2.05: Domain d4il2b1: 4il2 B:12-122

Lineage for d4il2b1 (4il2 B:12-122)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein D-mannonate dehydratase [267663] (1 species)

7. Species Escherichia coli [TaxId:199310] [267746] (1 PDB entry)

8. Domain d4il2b1: 4il2 B:12-122 [266442]
   Other proteins in same PDB: d4il2a2, d4il2b2, d4il2c2, d4il2d2
   complexed with mg

Details for d4il2b1

PDB Entry: 4il2, 1.95 Å

PDB Description: crystal structure of d-mannonate dehydratase (rspa) from e. coli cft073 (efi target efi-501585)

PDB Compounds: (B:) Starvation sensing protein rspA

SCOPe Domain Sequences for d4il2b1:

Sequence; same for both SEQRES and ATOM records:

>d4il2b1 d.54.1.1 (B:12-122) D-mannonate dehydratase {Escherichia coli [TaxId: 199310]}
mkivkaevfvtcpgrnfvtlkittedgitglgdatlngrelsvasylqdhlcpqligrda
hriediwqffykgaywrrgpvtmsaisavdmalwdikakaanmplyqllgg

Timeline for d4il2b1:

• d4il2b1 is new in SCOPe 2.05-stable
  
• d4il2b1 appears in SCOPe 2.06
  
• d4il2b1 appears in the current release, SCOPe 2.08