SCOP 1.71: Domain d1a9mb_: 1a9m B:

Lineage for d1a9mb_ (1a9m B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (179 PDB entries)

8. Domain d1a9mb_: 1a9m B: [26643]
   complexed with u0e; mutant

Details for d1a9mb_

PDB Entry: 1a9m, 2.3 Å

PDB Description: g48h mutant of hiv-1 protease in complex with a peptidic inhibitor u- 89360e

SCOP Domain Sequences for d1a9mb_:

Sequence; same for both SEQRES and ATOM records:

>d1a9mb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmihgiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d1a9mb_:

• d1a9mb_ first appeared (with stable ids) in SCOP 1.55
  
• d1a9mb_ appears in SCOP 1.69
  
• d1a9mb_ appears in SCOP 1.73
  
• d1a9mb_ appears in the current release, SCOPe 2.08