Lineage for d1a9ma_ (1a9m A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15696Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 15712Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 15713Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries)
  8. 15851Domain d1a9ma_: 1a9m A: [26642]

Details for d1a9ma_

PDB Entry: 1a9m (more details), 2.3 Å

PDB Description: g48h mutant of hiv-1 protease in complex with a peptidic inhibitor u-89360e

SCOP Domain Sequences for d1a9ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9ma_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmihgiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOP Domain Coordinates for d1a9ma_:

Click to download the PDB-style file with coordinates for d1a9ma_.
(The format of our PDB-style files is described here.)

Timeline for d1a9ma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a9mb_