SCOPe 2.08: Domain d4hz2a2: 4hz2 A:80-204

Lineage for d4hz2a2 (4hz2 A:80-204)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Xanthobacter autotrophicus [TaxId:78245] [267948] (1 PDB entry)

8. Domain d4hz2a2: 4hz2 A:80-204 [266372]
   Other proteins in same PDB: d4hz2a1, d4hz2a3, d4hz2b1, d4hz2b3
   automated match to d3m3ma2
   complexed with bez, gsh, unl

Details for d4hz2a2

PDB Entry: 4hz2, 1.5 Å

PDB Description: crystal structure of glutathione s-transferase xaut_3756 (target efi- 507152) from xanthobacter autotrophicus py2

PDB Compounds: (A:) Glutathione S-transferase domain

SCOPe Domain Sequences for d4hz2a2:

Sequence; same for both SEQRES and ATOM records:

>d4hz2a2 a.45.1.0 (A:80-204) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}
lpppglartrvhewlffeqyshepyiavarylkswlrqahlhearladcatrgaaaldvm
eqhlagepwlvgegptiadlalfaythraeeadfdlaqwpavlawvdrvaalpginlipp
ldeil

Timeline for d4hz2a2:

• d4hz2a2 first appeared in SCOPe 2.05
  
• d4hz2a2 appears in SCOPe 2.07