Lineage for d4hnkh_ (4hnk H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854150Species Plasmodium falciparum [TaxId:36329] [267940] (2 PDB entries)
  8. 2854158Domain d4hnkh_: 4hnk H: [266352]
    automated match to d2f6ib_
    complexed with gol

Details for d4hnkh_

PDB Entry: 4hnk (more details), 2.9 Å

PDB Description: Crystal structure of an Enzyme
PDB Compounds: (H:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d4hnkh_:

Sequence, based on SEQRES records: (download)

>d4hnkh_ c.14.1.0 (H:) automated matches {Plasmodium falciparum [TaxId: 36329]}
pslllskriiflsspiyphiseqiisqllyleyeskrkpihlyinstgdidnnkiinlng
itdvisivdvinyissdvytyclgkaygiacilassgkkgyrfslknssfclnqsysiip
fnqatnieiqnkeimntkkkvieiiskntekdtnvisnvlerdkyfnadeavdfklidhi
lek

Sequence, based on observed residues (ATOM records): (download)

>d4hnkh_ c.14.1.0 (H:) automated matches {Plasmodium falciparum [TaxId: 36329]}
pslllskriiflsspiyphiseqiisqllyleyeskrkpihlyinstgdidnnkiinlng
itdvisivdvinyissdvytyclgkaygiacilassgkkgyrfslknssfclnqsysiip
fnieiqnkeimntkkkvieiiskntekdtnvisnvlerdkyfnadeavdfklidhilek

SCOPe Domain Coordinates for d4hnkh_:

Click to download the PDB-style file with coordinates for d4hnkh_.
(The format of our PDB-style files is described here.)

Timeline for d4hnkh_: