Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (54 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [267940] (2 PDB entries) |
Domain d4gm2e_: 4gm2 E: [266326] automated match to d4mxic_ |
PDB Entry: 4gm2 (more details), 2.8 Å
SCOPe Domain Sequences for d4gm2e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gm2e_ c.14.1.0 (E:) automated matches {Plasmodium falciparum [TaxId: 36329]} pslllskriiflsspiyphiseqiisqllyleyeskrkpihlyinstgdidnnkiinlng itdvisivdvinyissdvytyclgkaygiacilassgkkgyrfslknssfclnqsysiip fnqatnieiqnkeimntkkkvieiiskntekdtnvisnvlerdkyfnadeavdfklidhi lek
Timeline for d4gm2e_: