SCOPe 2.05: Domain d4gisa1: 4gis A:-5-115

Lineage for d4gisa1 (4gis A:-5-115)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Vibrio harveyi [TaxId:673519] [267936] (3 PDB entries)

8. Domain d4gisa1: 4gis A:-5-115 [266318]
   Other proteins in same PDB: d4gisa2, d4gisb2
   automated match to d4ihca1
   complexed with cl, gol, mae, mg, mla

Details for d4gisa1

PDB Entry: 4gis, 1.8 Å

PDB Description: crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, glycerol and dicarboxylates bound (mixed loops, space group i4122)

PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d4gisa1:

Sequence; same for both SEQRES and ATOM records:

>d4gisa1 d.54.1.0 (A:-5-115) automated matches {Vibrio harveyi [TaxId: 673519]}
lyfqsmmnkntisniecvitkpdrhnlitvivetesgvtgygcatfqqrplavktmvdey
lkplligkdanniedlwqmmmvnaywrngpvinnaisgvdmalwdikakianmplhqlfg
g

Timeline for d4gisa1:

• d4gisa1 is new in SCOPe 2.05-stable
  
• d4gisa1 appears in SCOPe 2.06
  
• d4gisa1 appears in the current release, SCOPe 2.08