Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (74 species) not a true protein |
Species Vibrio harveyi [TaxId:673519] [267937] (3 PDB entries) |
Domain d4gira2: 4gir A:116-399 [266311] Other proteins in same PDB: d4gira1, d4girb1, d4girb3, d4girc1, d4gird1, d4gird3 automated match to d4ihca2 complexed with cl, edo, mg, na, so4 |
PDB Entry: 4gir (more details), 2 Å
SCOPe Domain Sequences for d4gira2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gira2 c.1.11.0 (A:116-399) automated matches {Vibrio harveyi [TaxId: 673519]} ksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfyggvpeniqtaqnptqgsy ydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiqfakqieqynpffiedilp psqtewldnirnqssvslalgelfnnpeewkaliinrrvdfirchvsqiggitpalklgh fcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveykantqrvfpnaaeping ylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsihtp
Timeline for d4gira2: