Lineage for d4gghb1 (4ggh B:3-115)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2192276Species Vibrio harveyi [TaxId:673519] [267936] (3 PDB entries)
  8. 2192278Domain d4gghb1: 4ggh B:3-115 [266298]
    Other proteins in same PDB: d4ggha2, d4gghb2, d4gghc2, d4gghd2
    automated match to d4ihca1
    complexed with cl, edo, epe, gol, mg

Details for d4gghb1

PDB Entry: 4ggh (more details), 1.9 Å

PDB Description: Crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, hepes, and ethylene glycol bound (ordered loops, space group c2221)
PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d4gghb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gghb1 d.54.1.0 (B:3-115) automated matches {Vibrio harveyi [TaxId: 673519]}
kntisniecvitkpdrhnlitvivetesgvtgygcatfqqrplavktmvdeylkplligk
danniedlwqmmmvnaywrngpvinnaisgvdmalwdikakianmplhqlfgg

SCOPe Domain Coordinates for d4gghb1:

Click to download the PDB-style file with coordinates for d4gghb1.
(The format of our PDB-style files is described here.)

Timeline for d4gghb1: