Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (74 species) not a true protein |
Species Vibrio harveyi [TaxId:673519] [267937] (3 PDB entries) |
Domain d4ggha2: 4ggh A:116-399 [266297] Other proteins in same PDB: d4ggha1, d4gghb1, d4gghc1, d4gghd1 automated match to d4ihca2 complexed with cl, edo, epe, gol, mg |
PDB Entry: 4ggh (more details), 1.9 Å
SCOPe Domain Sequences for d4ggha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ggha2 c.1.11.0 (A:116-399) automated matches {Vibrio harveyi [TaxId: 673519]} ksrdaiqvythatsdtmeglyeqvdkyleqgyqhircqlgfyggvpeniqtaqnptqgsy ydqdqyientvemfknlrekygkqfhilhdvherlfpnqaiqfakqieqynpffiedilp psqtewldnirnqssvslalgelfnnpeewkaliinrrvdfirchvsqiggitpalklgh fcesfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveykantqrvfpnaaeping ylyaseiagigvemdreaaqdfpveyrphewtqsrlpdgsihtp
Timeline for d4ggha2: