Lineage for d4g0dd1 (4g0d D:104-275)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964232Protein Collagenase-3 (MMP-13) [55540] (2 species)
  7. 2964233Species Human (Homo sapiens) [TaxId:9606] [55541] (47 PDB entries)
  8. 2964312Domain d4g0dd1: 4g0d D:104-275 [266293]
    Other proteins in same PDB: d4g0da2, d4g0db2, d4g0dc2, d4g0dd2
    automated match to d3ba0a1
    complexed with ca, cl, gol, peg, pgo, zn

Details for d4g0dd1

PDB Entry: 4g0d (more details), 2.54 Å

PDB Description: Human collagenase 3 (MMP-13) full form with peptides from pro-domain
PDB Compounds: (D:) collagenase 3

SCOPe Domain Sequences for d4g0dd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g0dd1 d.92.1.11 (D:104-275) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]}
ynvfprtlkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadi
misfgikehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaaha
fghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqslygpgdedpnp

SCOPe Domain Coordinates for d4g0dd1:

Click to download the PDB-style file with coordinates for d4g0dd1.
(The format of our PDB-style files is described here.)

Timeline for d4g0dd1: