Lineage for d1bv7a_ (1bv7 A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61252Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 61253Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 61254Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 61270Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 61271Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (119 PDB entries)
  8. 61422Domain d1bv7a_: 1bv7 A: [26629]

Details for d1bv7a_

PDB Entry: 1bv7 (more details), 2 Å

PDB Description: counteracting hiv-1 protease drug resistance: structural analysis of mutant proteases complexed with xv638 and sd146, cyclic urea amides with broad specificities

SCOP Domain Sequences for d1bv7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bv7a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpfniigrnlltqigctlnf

SCOP Domain Coordinates for d1bv7a_:

Click to download the PDB-style file with coordinates for d1bv7a_.
(The format of our PDB-style files is described here.)

Timeline for d1bv7a_: