Lineage for d4fyra3 (4fyr A:549-636)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2376781Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2376803Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2376804Protein automated matches [254707] (4 species)
    not a true protein
  7. 2376805Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries)
  8. 2376811Domain d4fyra3: 4fyr A:549-636 [266281]
    Other proteins in same PDB: d4fyra1, d4fyra2, d4fyra4, d4fyra5
    automated match to d4p8qa3
    complexed with acy, bes, bma, nag, so4, zn

Details for d4fyra3

PDB Entry: 4fyr (more details), 1.91 Å

PDB Description: human aminopeptidase n (cd13) in complex with bestatin
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4fyra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fyra3 b.1.30.0 (A:549-636) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpvitvdtstgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywlidvraq
ndlfstsgnewvllnlnvtgyyrvnyde

SCOPe Domain Coordinates for d4fyra3:

Click to download the PDB-style file with coordinates for d4fyra3.
(The format of our PDB-style files is described here.)

Timeline for d4fyra3: