Lineage for d4fyra2 (4fyr A:288-548)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1918487Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 1918488Protein automated matches [190805] (14 species)
    not a true protein
  7. 1918507Species Human (Homo sapiens) [TaxId:9606] [188286] (36 PDB entries)
  8. 1918520Domain d4fyra2: 4fyr A:288-548 [266280]
    Other proteins in same PDB: d4fyra1, d4fyra3, d4fyra4
    automated match to d4p8qa2
    complexed with acy, bes, nag, so4, zn

Details for d4fyra2

PDB Entry: 4fyr (more details), 1.91 Å

PDB Description: human aminopeptidase n (cd13) in complex with bestatin
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4fyra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fyra2 d.92.1.0 (A:288-548) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dyvekqasngvliriwarpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglp
dfnagamenwglvtyrensllfdplsssssnkervvtviahelahqwfgnlvtiewwndl
wlnegfasyveylgadyaeptwnlkdlmvlndvyrvmavdalasshplstpaseintpaq
iselfdaisyskgasvlrmlssflsedvfkqglasylhtfayqntiylnlwdhlqeavnn
rsiqlpttvrdimnrwtlqmg

SCOPe Domain Coordinates for d4fyra2:

Click to download the PDB-style file with coordinates for d4fyra2.
(The format of our PDB-style files is described here.)

Timeline for d4fyra2: