SCOPe 2.08: Domain d4fyra1: 4fyr A:66-287

Lineage for d4fyra1 (4fyr A:66-287)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.0: automated matches [254305] (1 protein)
   not a true family

6. Protein automated matches [254706] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries)

8. Domain d4fyra1: 4fyr A:66-287 [266279]
   Other proteins in same PDB: d4fyra2, d4fyra3, d4fyra4, d4fyra5
   automated match to d4p8qa1
   complexed with acy, bes, nag, so4, zn

Details for d4fyra1

PDB Entry: 4fyr, 1.91 Å

PDB Description: human aminopeptidase n (cd13) in complex with bestatin

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4fyra1:

Sequence; same for both SEQRES and ATOM records:

>d4fyra1 b.98.1.0 (A:66-287) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqskawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiihsk
klnytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefege
laddlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdlta
lsnmlpkgpstplpedpnwnvtefhttpkmstyllafivsef

Timeline for d4fyra1:

• d4fyra1 first appeared in SCOPe 2.05
  
• d4fyra1 appears in SCOPe 2.07