SCOPe 2.06: Domain d4fyqa2: 4fyq A:288-548

Lineage for d4fyqa2 (4fyq A:288-548)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188286] (43 PDB entries)

8. Domain d4fyqa2: 4fyq A:288-548 [266276]
   Other proteins in same PDB: d4fyqa1, d4fyqa3, d4fyqa4
   automated match to d4p8qa2
   complexed with acy, nag, so4, zn

Details for d4fyqa2

PDB Entry: 4fyq, 1.9 Å

PDB Description: human aminopeptidase n (cd13)

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4fyqa2:

Sequence; same for both SEQRES and ATOM records:

>d4fyqa2 d.92.1.0 (A:288-548) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dyvekqasngvliriwarpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglp
dfnagamenwglvtyrensllfdplsssssnkervvtviahelahqwfgnlvtiewwndl
wlnegfasyveylgadyaeptwnlkdlmvlndvyrvmavdalasshplstpaseintpaq
iselfdaisyskgasvlrmlssflsedvfkqglasylhtfayqntiylnlwdhlqeavnn
rsiqlpttvrdimnrwtlqmg

Timeline for d4fyqa2:

• d4fyqa2 first appeared in SCOPe 2.05
  
• d4fyqa2 appears in SCOPe 2.07
  
• d4fyqa2 appears in the current release, SCOPe 2.08