Lineage for d4fyqa1 (4fyq A:68-287)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1811467Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 1811468Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 1811535Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 1811536Protein automated matches [254706] (4 species)
    not a true protein
  7. 1811540Species Human (Homo sapiens) [TaxId:9606] [255964] (11 PDB entries)
  8. 1811543Domain d4fyqa1: 4fyq A:68-287 [266275]
    Other proteins in same PDB: d4fyqa2, d4fyqa3, d4fyqa4
    automated match to d4p8qa1
    complexed with acy, nag, so4, zn

Details for d4fyqa1

PDB Entry: 4fyq (more details), 1.9 Å

PDB Description: human aminopeptidase n (cd13)
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4fyqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fyqa1 b.98.1.0 (A:68-287) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiihskkl
nytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefegela
ddlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdltals
nmlpkgpstplpedpnwnvtefhttpkmstyllafivsef

SCOPe Domain Coordinates for d4fyqa1:

Click to download the PDB-style file with coordinates for d4fyqa1.
(The format of our PDB-style files is described here.)

Timeline for d4fyqa1: