Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (79 species) not a true protein |
Species Caulobacter sp. [TaxId:366602] [267934] (1 PDB entry) |
Domain d4fi4c2: 4fi4 C:113-403 [266254] Other proteins in same PDB: d4fi4a1, d4fi4a3, d4fi4b1, d4fi4c1 automated match to d4il2a2 complexed with cl, gol, mg, unl |
PDB Entry: 4fi4 (more details), 2 Å
SCOPe Domain Sequences for d4fi4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fi4c2 c.1.11.0 (C:113-403) automated matches {Caulobacter sp. [TaxId: 366602]} acregvmvyghangetiedtiaearkyqalgykairlqsgvpglpstygvsgdkmfyepa dgnlptenvwstskylkhapklfeaarealgddvhllhdvhhrltpieagrlgkdlepyr lfwledavpaenqagfrlirqhtttplavgeifshvwdckqlieeqlidylratvlhagg itnlrkiaafadlhhvrtgchgatdlspitmaaalhfdlsvsnfglqeymrhtpetdavf phaysykdgmlhpgeapglgvdidealagqypykraylpvnrledgtmynw
Timeline for d4fi4c2: