![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (94 species) not a true protein |
![]() | Species Caulobacter sp. [TaxId:366602] [267933] (1 PDB entry) |
![]() | Domain d4fi4c1: 4fi4 C:1-112 [266253] Other proteins in same PDB: d4fi4a2, d4fi4a3, d4fi4b2, d4fi4c2 automated match to d4il2a1 complexed with cl, gol, mg, unl |
PDB Entry: 4fi4 (more details), 2 Å
SCOPe Domain Sequences for d4fi4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fi4c1 d.54.1.0 (C:1-112) automated matches {Caulobacter sp. [TaxId: 366602]} mlkiidakvivtcpgrnfvtlkittsdgvtgvgdatlngrelavvsylrdhmipcligrd ahriedvwqffyrgsywrggpvamtalaavdmalwdikaklagmplyqllgg
Timeline for d4fi4c1: