Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (96 species) not a true protein |
Species Streptomyces toyocaensis [TaxId:55952] [267800] (4 PDB entries) |
Domain d4eecb_: 4eec B: [266178] automated match to d3niba_ complexed with a3p |
PDB Entry: 4eec (more details), 2.7 Å
SCOPe Domain Sequences for d4eecb_:
Sequence, based on SEQRES records: (download)
>d4eecb_ c.37.1.0 (B:) automated matches {Streptomyces toyocaensis [TaxId: 55952]} gsmcwiasypkagghwlrcmltsyvtgepvetwpgiqagvphlegllrdgeapsadpdeq vllathftadrpvlrfyrestakvvclirnprdamlslmrmkgippedveacrkiaetfi adegfssvriwagegswpenirswtdsvhesfpnaavlavryedlrkdpegelwkvvdfl elggrdgvadavanctlermremeerskllglettglmtrggkqlpfvgkggqrkslkfm gddiekayadllhgetdfahyarlygya
>d4eecb_ c.37.1.0 (B:) automated matches {Streptomyces toyocaensis [TaxId: 55952]} gsmcwiasypkagghwlrcmltsyvtgepvetwpgiqagvphlegllrdgeapsadpdeq vllathftadrpvlrfyrestakvvclirnprdamlslmrmkgippedveacrkiaetfi adegfssvriwagegswpenirswtdsvhesfpnaavlavryedlrkdpegelwkvvdfl elggrdgvadavanctlermremeerskkslkfmgddiekayadllhgetdfahyarlyg ya
Timeline for d4eecb_: