Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Pectobacterium carotovorum [TaxId:561230] [267926] (1 PDB entry) |
Domain d4e4fb1: 4e4f B:1-111 [266169] Other proteins in same PDB: d4e4fa2, d4e4fa3, d4e4fb2, d4e4fb3, d4e4fc2, d4e4fc3, d4e4fd2, d4e4fd3 automated match to d4il2a1 complexed with cl, fmt, gol, mg |
PDB Entry: 4e4f (more details), 2 Å
SCOPe Domain Sequences for d4e4fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e4fb1 d.54.1.0 (B:1-111) automated matches {Pectobacterium carotovorum [TaxId: 561230]} mkivsaevfvtcpgrnfvtlkittdsgltglgdatlngrelpvasylndhvcpqligrda hqiediwqyfykgaywrrgpvtmsaisavdmalwdikakaanmplyqllgg
Timeline for d4e4fb1: