SCOPe 2.08: Domain d4dqda_: 4dqd A:

Lineage for d4dqda_ (4dqd A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:316058] [256081] (3 PDB entries)

8. Domain d4dqda_: 4dqd A: [266159]
   automated match to d3sg0a_
   complexed with 3py, gol, pg4, ppy

Details for d4dqda_

PDB Entry: 4dqd, 1.6 Å

PDB Description: The crystal structure of a transporter in complex with 3-phenylpyruvic acid

PDB Compounds: (A:) Extracellular ligand-binding receptor

SCOPe Domain Sequences for d4dqda_:

Sequence; same for both SEQRES and ATOM records:

>d4dqda_ c.93.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
aeikigitmsasgpgaalgqpqsktvaalpkeiggekvtyfalddesdptkaaqnarkll
seekvdvligssltpvslplidiaaeaktplmtmaaaailvapmderrkwvykvvpnddi
maeaigkyiaktgakkvgyigfsdaygegyykvlaaaapklgfeltthevyarsdasvtg
qvlkiiatkpdavfiasagtpavlpqkalrergfkgaiyqthgvateefiklggkdvega
ifageafsgaedmpadspfrkvkarfvdaykaanggaaptifgvhlwdsmtlvenaipaa
lkaakpgtpefraairdqiekskdlalnnglsnmtpdnhngydersaflieirdgafrlk
q

Timeline for d4dqda_:

• d4dqda_ first appeared in SCOPe 2.05
  
• d4dqda_ appears in SCOPe 2.07