Lineage for d4dlea2 (4dle A:423-832)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246832Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2246833Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2246834Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2246835Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 2246901Species Thermus aquaticus [TaxId:271] [56676] (29 PDB entries)
  8. 2246928Domain d4dlea2: 4dle A:423-832 [266156]
    Other proteins in same PDB: d4dlea1
    automated match to d3rrha2
    protein/DNA complex; complexed with dct, edo, gol, mg, mn

Details for d4dlea2

PDB Entry: 4dle (more details), 2.44 Å

PDB Description: Ternary Structure of the large Fragment of Taq DNA Polymerase: 4-Fluoroproline Variant
PDB Compounds: (A:) DNA polymerase I, thermostable

SCOPe Domain Sequences for d4dlea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dlea2 e.8.1.1 (A:423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]}
eerllwlyreverxlsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghxf
nlnsrdqlervlfdelglxaigktektgkrstsaavlealreahxivekilqyreltklk
styidxlxdlihxrtgrlhtrfnqtatatgrlsssdxnlqnixvrtxlgqrirrafiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvxreavdxlmrraa
ktinfgvlygmsahrlsqelaixyeeaqafieryfqsfxkvrawiektleegrrrgyvet
lfgrrryvxdlearvksvreaaermafnmxvqgtaadlmklamvklfxrleemgarmllq
vhdelvleaxkeraeavarlakevmegvyxlavxlevevgigedwlsake

SCOPe Domain Coordinates for d4dlea2:

Click to download the PDB-style file with coordinates for d4dlea2.
(The format of our PDB-style files is described here.)

Timeline for d4dlea2: