SCOPe 2.08: Domain d4czja1: 4czj A:12-149

Lineage for d4czja1 (4czj A:12-149)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Caulobacter vibrioides [TaxId:155892] [256751] (9 PDB entries)

8. Domain d4czja1: 4czj A:12-149 [266126]
   automated match to d4czfa1
   complexed with anp, mg

Details for d4czja1

PDB Entry: 4czj, 2 Å

PDB Description: C. crescentus MreB, double filament, AMPPNP

PDB Compounds: (A:) rod shape-determining protein mreb

SCOPe Domain Sequences for d4czja1:

Sequence, based on SEQRES records:

>d4czja1 c.55.1.0 (A:12-149) automated matches {Caulobacter vibrioides [TaxId: 155892]}
diaidlgtantliyqkgkgivlnepsvvalrnvggrkvvhavgieakqmlgrtpghmeai
rpmrdgviadfevaeemikyfirkvhnrkgsgnpkvivcvpsgataverraindsclnag
arrvglidepmaaaigag

Sequence, based on observed residues (ATOM records):

>d4czja1 c.55.1.0 (A:12-149) automated matches {Caulobacter vibrioides [TaxId: 155892]}
diaidlgtantliyqkgkgivlnepsvvalrnvggrkvvhavgieakqmlgrtpghmeai
rpmrdgviadfevaeemikyfirkvhnpkvivcvpsgataverraindsclnagarrvgl
idepmaaaigag

Timeline for d4czja1:

• d4czja1 first appeared in SCOPe 2.05
  
• d4czja1 appears in SCOPe 2.07