Lineage for d4ct5a1 (4ct5 A:95-301)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1849890Species Human (Homo sapiens) [TaxId:9606] [186862] (102 PDB entries)
  8. 1850067Domain d4ct5a1: 4ct5 A:95-301 [266080]
    automated match to d4ct4b1
    complexed with act

Details for d4ct5a1

PDB Entry: 4ct5 (more details), 3 Å

PDB Description: ddx6
PDB Compounds: (A:) ddx6

SCOPe Domain Sequences for d4ct5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ct5a1 c.37.1.0 (A:95-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gnefedyclkrellmgifemgwekpspiqeesipialsgrdilarakngtgksgaylipl
lerldlkkdniqamvivptrelalqvsqiciqvskhmggakvmattggtnlrddimrldd
tvhvviatpgrildlikkgvakvdhvqmivldeadkllsqdfvqimediiltlpknrqil
lysatfplsvqkfmnshlqkpyeinlm

SCOPe Domain Coordinates for d4ct5a1:

Click to download the PDB-style file with coordinates for d4ct5a1.
(The format of our PDB-style files is described here.)

Timeline for d4ct5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ct5a2