SCOPe 2.05: Domain d4cqxb_: 4cqx B:

Lineage for d4cqxb_ (4cqx B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus (a/turkey/turkey/1/2005(h5n1)) [TaxId:375457] [256678] (4 PDB entries)

8. Domain d4cqxb_: 4cqx B: [266067]
   Other proteins in same PDB: d4cqxa_, d4cqxc_, d4cqxe_
   automated match to d2fk0b1
   complexed with nag, po4; mutant

Details for d4cqxb_

PDB Entry: 4cqx, 2.3 Å

PDB Description: h5 (tyty) del133/ile155thr mutant haemagglutinin in complex with human receptor analogue 6'sln

PDB Compounds: (B:) haemagglutinin ha2

SCOPe Domain Sequences for d4cqxb_:

Sequence; same for both SEQRES and ATOM records:

>d4cqxb_ h.3.1.1 (B:) automated matches {Influenza a virus (a/turkey/turkey/1/2005(h5n1)) [TaxId: 375457]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhrcdnecmesvrngtydypqys

Timeline for d4cqxb_:

• d4cqxb_ is new in SCOPe 2.05-stable
  
• d4cqxb_ appears in SCOPe 2.06
  
• d4cqxb_ appears in the current release, SCOPe 2.08