![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
![]() | Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) ![]() |
![]() | Family c.48.1.0: automated matches [227237] (1 protein) not a true family |
![]() | Protein automated matches [226991] (5 species) not a true protein |
![]() | Species Lactobacillus salivarius [TaxId:362948] [260147] (2 PDB entries) |
![]() | Domain d4c7xa3: 4c7x A:527-662 [265993] Other proteins in same PDB: d4c7xa1, d4c7xa2 automated match to d4c7va3 complexed with mg, tpp |
PDB Entry: 4c7x (more details), 2.29 Å
SCOPe Domain Sequences for d4c7xa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c7xa3 c.48.1.0 (A:527-662) automated matches {Lactobacillus salivarius [TaxId: 362948]} piskekvfdgvekggyvvqgaeneadgiliatgsevglalkakeelqkkgkdvivvslps werfeaqseeykntvippelkkrmtieagttygwakyagdhgvmigidefgmsapsdivl relgmsvenivdkyle
Timeline for d4c7xa3: