SCOPe 2.06: Domain d4c7xa2: 4c7x A:337-526

Lineage for d4c7xa2 (4c7x A:337-526)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (20 species)
   not a true protein

7. Species Lactobacillus salivarius [TaxId:362948] [260140] (2 PDB entries)

8. Domain d4c7xa2: 4c7x A:337-526 [265992]
   Other proteins in same PDB: d4c7xa3, d4c7xa4
   automated match to d4c7va2
   complexed with mg, tpp

Details for d4c7xa2

PDB Entry: 4c7x, 2.29 Å

PDB Description: thiamine pyrophosphate bound transketolase from lactobacillus salivarius at 2.2a resolution

PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d4c7xa2:

Sequence; same for both SEQRES and ATOM records:

>d4c7xa2 c.36.1.0 (A:337-526) automated matches {Lactobacillus salivarius [TaxId: 362948]}
vpntlgdilpqygeddsiatraasqkainalakevsslwggaadlassnktviagegdfq
pesyegrniwfgvrefgmacamngimlhggtrifgstffvfsdylkaairlsaiqklpvi
yvlthdsvavgkdgpthepieqlaslrtipnvqvfrpadgnetsaawkvaletldkptil
vlsrqnldtl

Timeline for d4c7xa2:

• d4c7xa2 first appeared in SCOPe 2.05
  
• d4c7xa2 appears in SCOPe 2.07
  
• d4c7xa2 appears in the current release, SCOPe 2.08