![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
![]() | Protein automated matches [227126] (20 species) not a true protein |
![]() | Species Lactobacillus salivarius [TaxId:362948] [260140] (2 PDB entries) |
![]() | Domain d4c7xa1: 4c7x A:2-336 [265991] Other proteins in same PDB: d4c7xa3, d4c7xa4 automated match to d4c7va1 complexed with mg, tpp |
PDB Entry: 4c7x (more details), 2.29 Å
SCOPe Domain Sequences for d4c7xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c7xa1 c.36.1.0 (A:2-336) automated matches {Lactobacillus salivarius [TaxId: 362948]} ydqvdqlgvntlrtlsidaiqransghpglpmgaapmayvlwtrhlkinpkthmnwvnrd rfvlsaghgsallyslahlagydvsmddlknfrewksntpghpeygctdgveattgplgq gismavgmamaeahlgkkfnregypvmdhytyaligdgdlmegvaseaaslaghlklgkl ialydsngisldgktsasftenvgarfeaygwqyilvedgfnleeidkaivqakaesdkp tiieikttigygsenqgthkvhgsplgeegvahakevynwnyppftvpeevsqrfkeclq dkgvkaenkwnemfeaykkeysdlaqkfsdgfsnk
Timeline for d4c7xa1: