Lineage for d1hvsb_ (1hvs B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15696Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 15712Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 15713Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries)
  8. 15813Domain d1hvsb_: 1hvs B: [26598]

Details for d1hvsb_

PDB Entry: 1hvs (more details), 2.25 Å

PDB Description: structural basis of drug resistance for the v82a mutant of hiv-1 protease: backbone flexibility and subsite repacking

SCOP Domain Sequences for d1hvsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hvsb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpaniigrnlltqigctlnf

SCOP Domain Coordinates for d1hvsb_:

Click to download the PDB-style file with coordinates for d1hvsb_.
(The format of our PDB-style files is described here.)

Timeline for d1hvsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hvsa_