SCOPe 2.06: Domain d4bzqa_: 4bzq A:

Lineage for d4bzqa_ (4bzq A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189039] (15 PDB entries)

8. Domain d4bzqa_: 4bzq A: [265961]
   automated match to d4bzpa_
   complexed with adp, adx, cit, edo

Details for d4bzqa_

PDB Entry: 4bzq, 2.1 Å

PDB Description: structure of the mycobacterium tuberculosis aps kinase cysc in complex with adp and aps

PDB Compounds: (A:) bifunctional enzyme cysn/cysc

SCOPe Domain Sequences for d4bzqa_:

Sequence; same for both SEQRES and ATOM records:

>d4bzqa_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pprgktvwftglsgsgkssvamlverkllekgisayvldgdnlrhglnadlgfsmadrae
nlrrlshvatlladcghlvlvpaisplaehralarkvhadagidffevfcdtplqdcerr
dpkglyakarageithftgidspyqrpknpdlrltpdrsideqaqevidlles

Timeline for d4bzqa_:

• d4bzqa_ first appeared in SCOPe 2.05
  
• d4bzqa_ appears in SCOPe 2.07
  
• d4bzqa_ appears in the current release, SCOPe 2.08