SCOPe 2.08: Domain d4bwja1: 4bwj A:294-422

Lineage for d4bwja1 (4bwj A:294-422)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Thermus aquaticus [TaxId:271] [267867] (4 PDB entries)

8. Domain d4bwja1: 4bwj A:294-422 [265957]
   Other proteins in same PDB: d4bwja2
   automated match to d1bgxt3
   protein/DNA complex; complexed with dct, mg; mutant

Details for d4bwja1

PDB Entry: 4bwj, 1.55 Å

PDB Description: klentaq mutant in complex with dna and ddctp

PDB Compounds: (A:) DNA polymerase I, thermostable

SCOPe Domain Sequences for d4bwja1:

Sequence; same for both SEQRES and ATOM records:

>d4bwja1 c.55.3.0 (A:294-422) automated matches {Thermus aquaticus [TaxId: 271]}
leeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkearglla
kdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlf
anlwgrleg

Timeline for d4bwja1:

• d4bwja1 first appeared in SCOPe 2.05
  
• d4bwja1 appears in SCOPe 2.07