SCOPe 2.06: Domain d4b0na2: 4b0n A:266-414

Lineage for d4b0na2 (4b0n A:266-414)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Ectocarpus siliculosus [TaxId:2880] [267920] (1 PDB entry)

8. Domain d4b0na2: 4b0n A:266-414 [265910]
   automated match to d1teda2
   complexed with acd, mla

Details for d4b0na2

PDB Entry: 4b0n, 2.85 Å

PDB Description: crystal structure of pks-i from the brown algae ectocarpus siliculosus

PDB Compounds: (A:) polyketide synthase III

SCOPe Domain Sequences for d4b0na2:

Sequence; same for both SEQRES and ATOM records:

>d4b0na2 c.95.1.0 (A:266-414) automated matches {Ectocarpus siliculosus [TaxId: 2880]}
aivdnhawlmegtedgitlaikpngitctlskflpqyiakniaffadgflkkhklgrddv
dfwcvhpggrriieeaqnglglseeqtadswavlgeygnmlspsvmfvlsrvfkrhnaal
aqgkpgyqtgmafsfspgvgaegillrqi

Timeline for d4b0na2:

• d4b0na2 first appeared in SCOPe 2.05
  
• d4b0na2 appears in SCOPe 2.07
  
• d4b0na2 appears in the current release, SCOPe 2.08