Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (60 species) not a true protein |
Species Ectocarpus siliculosus [TaxId:2880] [267920] (1 PDB entry) |
Domain d4b0na2: 4b0n A:266-414 [265910] automated match to d1teda2 complexed with acd, mla |
PDB Entry: 4b0n (more details), 2.85 Å
SCOPe Domain Sequences for d4b0na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b0na2 c.95.1.0 (A:266-414) automated matches {Ectocarpus siliculosus [TaxId: 2880]} aivdnhawlmegtedgitlaikpngitctlskflpqyiakniaffadgflkkhklgrddv dfwcvhpggrriieeaqnglglseeqtadswavlgeygnmlspsvmfvlsrvfkrhnaal aqgkpgyqtgmafsfspgvgaegillrqi
Timeline for d4b0na2: