Lineage for d4az1b_ (4az1 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875762Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2875763Protein automated matches [190475] (10 species)
    not a true protein
  7. 2876001Species Trypanosoma cruzi [TaxId:5693] [267919] (1 PDB entry)
  8. 2876003Domain d4az1b_: 4az1 B: [265908]
    automated match to d3m4ub_
    complexed with edo, fmt

Details for d4az1b_

PDB Entry: 4az1 (more details), 2.18 Å

PDB Description: Crystal structure of the Trypanosoma cruzi protein tyrosine phosphatase TcPTP1, a potential therapeutic target for Chagas' disease
PDB Compounds: (B:) tyrosine specific protein phosphatase

SCOPe Domain Sequences for d4az1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4az1b_ c.45.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
sncfpftklsvqaqyervqrefslllrqedprsisfatslknrhknryldilaneatlyp
qvtdapgastpyyingnlidldlphkfvacqapvvqgipdflamlyekkislvimvtkle
eggfvkadrywpeergsgsiavsgncgltisedpgkayevedelkitrrylilqradepp
hkftqvqytgwpdhgipqsatslealltnvknspttvpvvvhcsagigrtgtligayaal
thlergtltdttvydvvsamrrqrfgmvqrmeqyfviyltlmcrlgvdikal

SCOPe Domain Coordinates for d4az1b_:

Click to download the PDB-style file with coordinates for d4az1b_.
(The format of our PDB-style files is described here.)

Timeline for d4az1b_: