Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (22 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186998] (7 PDB entries) |
Domain d4aswc_: 4asw C: [265906] automated match to d2dzia_ |
PDB Entry: 4asw (more details)
SCOPe Domain Sequences for d4aswc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aswc_ d.15.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnlfls dlkvtpanstitvmikpnp
Timeline for d4aswc_: