SCOP 1.55: Domain d1bwab_: 1bwa B:

Lineage for d1bwab_ (1bwa B:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries)

8. Domain d1bwab_: 1bwa B: [26590]

Details for d1bwab_

PDB Entry: 1bwa, 1.9 Å

PDB Description: hiv-1 protease (v82f/i84v) double mutant complexed with xv638 of dupont pharmaceuticals

SCOP Domain Sequences for d1bwab_:

Sequence; same for both SEQRES and ATOM records:

>d1bwab_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpfnvigrnlltqigctlnf

Timeline for d1bwab_:

• d1bwab_ appears in SCOP 1.57
  
• d1bwab_ appears in the current release, SCOPe 2.08