Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (72 species) not a true protein |
Species Pyrococcus furiosus [TaxId:2261] [267914] (1 PDB entry) |
Domain d3wq8h_: 3wq8 H: [265729] automated match to d2jf7a_ mutant |
PDB Entry: 3wq8 (more details), 2.81 Å
SCOPe Domain Sequences for d3wq8h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wq8h_ c.1.8.0 (H:) automated matches {Pyrococcus furiosus [TaxId: 2261]} kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw igvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyln nayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqg frmrfglvyvdfetkkrylrpsalvsvk
Timeline for d3wq8h_: